Logo Lucerna-Chem
+41 41 420 9636



Sample Type

Article Status

Anti- FZD10 (Frizzled-10, Frizzled Family Receptor 10)

Catalog Number Pack Size List Price* Quantity
481445 100ul 582,00 Add

* CHF, excl. 7.7% VAT and shipping costs

Product Description

Category Antibody
Supplier USBiological
Application IF
Immunogen Synthetic peptide corresponding to the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH
Host Rb
Isotype IgG
Clonality Pab
Format Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Grade Affinity Purified
Purity Purified by affinity chromatography.
Storage Conditions -20°C
Product Line Research
Tech. Data Sheet View datasheet
Link To Supplier https://www.usbio.net
Shipping Details Blue Ice
Material Safety Data Sheet Download PDF
Call us

Customer Support
T +41 41 420 96 36
F +41 41 420 96 56

Business Hours
From Monday through Friday
08:00 – 12:00
13:00 – 17:00

Ask us

Technical Support

Business Development

Postal address
Lucerna-Chem AG
Abendweg 18
CH-6006 Luzern


If you have already subscribed to our newsletter and would like to update your details or cancel it, please click here.

© Copyright 2020 Lucerna-Chem AG, Switzerland