Logo Lucerna-Chem
+41 41 420 9636

Regulatory Status

Article Status

Anti- Toll-like Receptor 4

Catalog Number Pack Size List Price* Quantity
378618-200uG 200ug 1'077,00 Add

* CHF, excl. 7.7% VAT and shipping costs

Product Description

Category Antibody
Supplier USBiological
Application ICC, IHC, WB
Regulatory Status RUO
Species Specificity Hu
Immunogen Synthetic peptide corresponding to L161IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC192, aa161-192 of human TLR4 at N-terminal
Host Gt
Isotype IgG
Crossreactivity Hu, Ms
Clonality Pab
Format Supplied as a liquid in PBS, 0.09% sodium azide.
Grade Affinity Purified
Purity Epitope-affinity purified IgG.
Storage Conditions -20°C
Product Line Research
Tech. Data Sheet View datasheet
Link To Supplier https://www.usbio.net
Shipping Details Blue Ice
Material Safety Data Sheet Download PDF
Call us

Customer Support
T +41 41 420 96 36
F +41 41 420 96 56

Business Hours
From Monday through Friday
08:00 – 12:00
13:00 – 17:00

Ask us

Technical Support

Business Development

Postal address
Lucerna-Chem AG
Abendweg 18
CH-6006 Luzern


If you have already subscribed to our newsletter and would like to update your details or cancel it, please click here.

© Copyright 2021 Lucerna-Chem AG, Switzerland