Anti-FABP4 Polyclonal Antibody


Catalog Number Pack Size List Price* Quantity
39-2008-100 100 µg/vial 680,00 Add

* CHF, excl. 8.1% VAT and shipping costs


Product Description

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. Reconstitute : Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Category Antibody
Supplier Abeomics
Application WB, IHC-P
Regulatory Status RUO
Species Specificity Ms
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of Human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related Mouse and Rat sequences.
Host Rb
Genebank 2167
Isotype IgG
Crossreactivity Rt
Clonality Pab
Format Lyophilized
Working Dilution Western blot : 0.1-0.5µg/ml; Immunohistochemistry(Paraffin-embedded Section) : 0.5-1µg/ml
Purity Immunogen affinity purified.
Storage Conditions At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
References https://shop.lucerna-chem.ch
Tech. Data Sheet View datasheet
Link To Supplier https://www.abeomics.com
Material Safety Data Sheet Download PDF