Anti-FABP4 Polyclonal Antibody
Catalog Number | Pack Size | List Price* | Quantity | |
---|---|---|---|---|
39-2008-100 | 100 µg/vial | 680,00 | Add |
* CHF, excl. 8.1% VAT and shipping costs
Product Description
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. Reconstitute : Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Category | Antibody |
Supplier | Abeomics |
Application | WB, IHC-P |
Regulatory Status | RUO |
Species Specificity | Ms |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of Human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related Mouse and Rat sequences. |
Host | Rb |
Genebank | 2167 |
Isotype | IgG |
Crossreactivity | Rt |
Clonality | Pab |
Format | Lyophilized |
Working Dilution | Western blot : 0.1-0.5µg/ml; Immunohistochemistry(Paraffin-embedded Section) : 0.5-1µg/ml |
Purity | Immunogen affinity purified. |
Storage Conditions | At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing. |
References | https://shop.lucerna-chem.ch |
Tech. Data Sheet | View datasheet |
Link To Supplier | https://www.abeomics.com |
Material Safety Data Sheet | Download PDF |